Protein Info for RR42_RS02930 in Cupriavidus basilensis FW507-4G11
Annotation: AsnC family transcriptional regulator
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 59% identical to BKDR_PSEPU: Bkd operon transcriptional regulator (bkdR) from Pseudomonas putida
KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 92% identity to rme:Rmet_4559)Predicted SEED Role
"Transcriptional regulator BkdR of isoleucine and valine catabolism operon" in subsystem Isoleucine degradation or Valine degradation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C4Y578 at UniProt or InterPro
Protein Sequence (156 amino acids)
>RR42_RS02930 AsnC family transcriptional regulator (Cupriavidus basilensis FW507-4G11) MLDIDLDATDIRILNELQRDASLTNVELASRVSLSPSPCLARVKQLEKQGVISRRVTLLD ARRLGLKVVVFIQISLDKQRRETLDAFERRITTLPQVMECYLMSGDADYLLRVVVADVEA LERLIIDQITRIPGVSSIRSSFALKQVLYSTALPLG