Protein Info for RR42_RS02900 in Cupriavidus basilensis FW507-4G11

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF00126: HTH_1" amino acids 10 to 67 (58 residues), 73.6 bits, see alignment E=1e-24 PF03466: LysR_substrate" amino acids 92 to 294 (203 residues), 114.2 bits, see alignment E=5.9e-37

Best Hits

KEGG orthology group: None (inferred from 74% identity to reh:H16_A1645)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBQ2 at UniProt or InterPro

Protein Sequence (313 amino acids)

>RR42_RS02900 LysR family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MSASRIPSLSSLRAFEAAARHQNLRRAAAELCLSESAVSRQIATLESQLGVALFHRANQR
VSLTPAGSLYGYQVRESLQKLQRDTLDIMAHEGAGGIVELACVPTLAVEWLIPRLPAFYA
QHPQVVVNFSAQADVFLFDGTPYDAAIHYGEANYPGGRADPLFDEESVPICHPELFAGEG
PVSAQRIARAPLLHLSTRRLDWKNWMEAAGVGDVNAMRGTRYDHHSMVISAARAKLGVGL
VPRFLVEEYLALGLLAMPVAQAMRSQRAYYLVAPDSRPMSDAMSRLRTWLLAAAQDFAAR
QASGRAPGLARDI