Protein Info for RR42_RS02750 in Cupriavidus basilensis FW507-4G11

Annotation: mannose-1-phosphate guanylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00483: NTP_transferase" amino acids 2 to 130 (129 residues), 83.2 bits, see alignment E=2.2e-27 PF12804: NTP_transf_3" amino acids 3 to 125 (123 residues), 47.1 bits, see alignment E=3e-16

Best Hits

Swiss-Prot: 51% identical to MURU_NEIMB: N-acetylmuramate alpha-1-phosphate uridylyltransferase (murU) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: None (inferred from 81% identity to reu:Reut_A0493)

Predicted SEED Role

"Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 2.7.7.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y535 at UniProt or InterPro

Protein Sequence (246 amino acids)

>RR42_RS02750 mannose-1-phosphate guanylyltransferase (Cupriavidus basilensis FW507-4G11)
MKAMIFAAGRGERMRPLTDAHPKPLLPVGGKPLIVWKIEALARAGFKDIVINHAWLGEQI
EQALGDGNRFGVRLAYSAEPSALETAGGIAQALPLLSAAPERGEIFLAVSGDIFTDYDFR
ALLPRARAMAGAPEPRMHLVMVPNPPFHPDGDFALGADGLLLPTPTATAPSLTFGNIGLY
DTRLFTAIEPGQKVAMTPYYRAAVAAGLASGERFDGAWENVGTPAQLAALDATVLARAGT
ACAPLP