Protein Info for RR42_RS02470 in Cupriavidus basilensis FW507-4G11

Annotation: dihydroneopterin triphosphate pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 7 to 137 (131 residues), 54.8 bits, E=5.3e-19

Best Hits

KEGG orthology group: K08310, dATP pyrophosphohydrolase [EC: 3.6.1.-] (inferred from 85% identity to reh:H16_A0455)

Predicted SEED Role

"Dihydroneopterin triphosphate pyrophosphohydolase type 2" in subsystem Folate Biosynthesis or Queuosine-Archaeosine Biosynthesis

MetaCyc Pathways

• superpathway of chorismate metabolism (45/59 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (4/5 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

See A0A0C4YBF5 at UniProt or InterPro

Protein Sequence (157 amino acids)

>RR42_RS02470 dihydroneopterin triphosphate pyrophosphatase (Cupriavidus basilensis FW507-4G11)
MSYKIPESVLVVIHTPDLQVLLIERADRPGYWQSVTGSLDTPDEPLALTAAREVAEETGL
IAAEHQLDDWNHTIEYEIYPQWRHRYAPGVTRNTEHWFGLRVAQPLPVTLAPREHLQYQW
LPWREAAALCFSSSNAEAVLQLGWRVRGQRAACGADL