Protein Info for RR42_RS02455 in Cupriavidus basilensis FW507-4G11

Annotation: agmatinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR01230: agmatinase" amino acids 42 to 318 (277 residues), 200.7 bits, see alignment E=1.9e-63 PF00491: Arginase" amino acids 46 to 318 (273 residues), 313.9 bits, see alignment E=5.6e-98

Best Hits

Swiss-Prot: 70% identical to GBUA_PSEAE: Guanidinobutyrase (gbuA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01480, agmatinase [EC: 3.5.3.11] (inferred from 92% identity to rpf:Rpic12D_2148)

MetaCyc: 71% identical to guanidinobutyrase subunit (Pseudomonas putida)
Guanidinobutyrase. [EC: 3.5.3.7]

Predicted SEED Role

"Agmatinase (EC 3.5.3.11)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.11 or 3.5.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4X5 at UniProt or InterPro

Protein Sequence (328 amino acids)

>RR42_RS02455 agmatinase (Cupriavidus basilensis FW507-4G11)
MHVNTPRHPADEAGLFQPMSGNAMPRFGGIATMMRLPAAASTAGLDACFVGVPFDLGTSN
RNGARLGPRQIRAESVLLRPYNMATRAAPFDSLRVADIGDVATNPYNLHDAIARIEAAYR
DIIATGCRPIGLGGDHTVTLPILRAMHARHGRLGLIHVDAHADVNDTMFGEKIAHGTPFR
RAVEEGLLDCGRVVQIGLRGTGYAAEDFDWCRQQGFRVITAEACWYRSLAPLMEEIGMRL
QGGPVYISFDIDGIDPAYAPGTGTPEIGGLTVPQALEIIRGARGLDIVGADLVEVSPPYD
PFGTTALLGANLAFELLCVLPGVVYRGA