Protein Info for RR42_RS02390 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 transmembrane" amino acids 45 to 66 (22 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 39 to 314 (276 residues), 194.3 bits, see alignment E=4.1e-61 PF05992: SbmA_BacA" amino acids 52 to 364 (313 residues), 139.5 bits, see alignment E=2.7e-44 PF00005: ABC_tran" amino acids 424 to 556 (133 residues), 61.8 bits, see alignment E=1.6e-20

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 84% identity to reh:H16_A0443)

Predicted SEED Role

"ABC transporter, fused ATPase and inner membrane subunits (EC 3.6.3.27)" (EC 3.6.3.27)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.27

Use Curated BLAST to search for 3.6.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y6X2 at UniProt or InterPro

Protein Sequence (627 amino acids)

>RR42_RS02390 ABC transporter ATP-binding protein (Cupriavidus basilensis FW507-4G11)
MSTPSSVTVPGPAVPARALRIQSRLRVAETWDLIKPYWISEDRKAGLGLLAFVVALNLGI
VYINVLLNEWNRVFYNALEQHDYTSFKALLIRFSWIAGFFIVAAISRQYYTMMLQMRWRT
WMTDRFMDHWLSHQAYYRIEQTHATDNPDQRLADDLRSFTDGALSLSLGLLNSVVTLVSF
VGILWAVSGPISFMLGGTEITIPGYMVWFAVGYAVIGSLIAHVVGRPLIGLSFQQEQYEA
DFRFMLVRLRENSEPVALYRGEPTEQAGLRSRFDRIRANWKQLMRYTRRLTFVSSGYGQF
AIIFPLLVAAPRYFAGKMTLGGLMQVSQAFGQVQGALSWFVDNYSTLVGWKAAANRLIDF
RDAIRVAERQDQEHTGVRDIEVVQAGTGTDSGGIRIDTLALALPVRTGNGNGGEIQQRLL
VAAFSLQIAPGERWLVSGPSGCGKSVLFRALAGIWPYGSGKVAMPGAARMLFLPQRSYLP
IGTLADALAYPDAGTVHSREALQKVLREAWLGALAEQLDVFDNWSLRLSPGEQQRLAFAR
ALLQKPDYLFLDEATSALDEETESEMYRLMVDSLPGAAIISIAHRSTVAAFHGKRLRYVA
ADGAHWEAEHDGQGEAAAVSYRVVHEA