Protein Info for RR42_RS02320 in Cupriavidus basilensis FW507-4G11

Annotation: trehalose phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR00685: trehalose-phosphatase" amino acids 11 to 235 (225 residues), 138.4 bits, see alignment E=3.8e-44 TIGR01484: HAD hydrolase, family IIB" amino acids 13 to 205 (193 residues), 72.4 bits, see alignment E=5.5e-24 PF02358: Trehalose_PPase" amino acids 14 to 217 (204 residues), 113.5 bits, see alignment E=8.8e-37

Best Hits

Swiss-Prot: 42% identical to OTSB_SALTY: Trehalose-phosphate phosphatase (otsB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01087, trehalose-phosphatase [EC: 3.1.3.12] (inferred from 73% identity to reu:Reut_A0414)

Predicted SEED Role

"Trehalose-6-phosphate phosphatase (EC 3.1.3.12)" in subsystem Trehalose Biosynthesis (EC 3.1.3.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4M8 at UniProt or InterPro

Protein Sequence (261 amino acids)

>RR42_RS02320 trehalose phosphatase (Cupriavidus basilensis FW507-4G11)
MPSLPLIEPNTALFLDFDGTLADLAPRPDLVQVEPELVGTLRALHLHLGGAVALVSGRPI
AELDHFLQPLQLPCAGVHGAELRDAGGQRLRQPDPGVPLLLPPLEALVGAHPGLQLERKS
VAVAVHYRAVPHLEGMVRNFAAELAGGVPGIEVLHGKMVVELKPAGIDKGGAINAFMRSP
PFARRTPLFAGDDITDEAGFAVVRRLGGVGLLVGARPSAATASVTGPAALRCWLHRSAKA
LEVMAAAQGTQVSGATSTTTS