Protein Info for RR42_RS02245 in Cupriavidus basilensis FW507-4G11
Annotation: flagellar protein FlgA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.
Best Hits
Swiss-Prot: 55% identical to SUYA_CHRSD: (2R)-sulfolactate sulfo-lyase subunit alpha (suyA) from Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)
KEGG orthology group: K01726, [EC: 4.2.1.-] (inferred from 89% identity to reu:Reut_C6088)MetaCyc: 55% identical to R-sulfolactate sulfo-lyase A subunit (Chromohalobacter salexigens DSM 3043)
Sulfolactate sulfo-lyase. [EC: 4.4.1.24]
Predicted SEED Role
"Hydrolase, UxaA family"
MetaCyc Pathways
- (R)-cysteate degradation (2/3 steps found)
- sulfolactate degradation I (2/3 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Benzoate degradation via CoA ligation
- Benzoate degradation via hydroxylation
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Cysteine metabolism
- Fatty acid biosynthesis
- Limonene and pinene degradation
- Nucleotide sugars metabolism
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Porphyrin and chlorophyll metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.2.1.-
Use Curated BLAST to search for 4.2.1.- or 4.4.1.24
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C4Y4T7 at UniProt or InterPro
Protein Sequence (93 amino acids)
>RR42_RS02245 flagellar protein FlgA (Cupriavidus basilensis FW507-4G11) MIHVVLHDAKDTVAVAVVEGIEAGTELNAWIMDEDKVITVVAKQPIPIGHKVALRDMEVG QTVFKYGIDIGKVVAPITAGDHAHVHNIKTKRW