Protein Info for RR42_RS02215 in Cupriavidus basilensis FW507-4G11

Annotation: fumarate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF13085: Fer2_3" amino acids 6 to 107 (102 residues), 92.7 bits, see alignment E=2.9e-30 TIGR00384: succinate dehydrogenase and fumarate reductase iron-sulfur protein" amino acids 14 to 225 (212 residues), 186.9 bits, see alignment E=1.7e-59 PF13237: Fer4_10" amino acids 144 to 212 (69 residues), 25.8 bits, see alignment E=1.7e-09 PF13183: Fer4_8" amino acids 144 to 214 (71 residues), 33.2 bits, see alignment E=1.3e-11 PF13534: Fer4_17" amino acids 144 to 215 (72 residues), 35 bits, see alignment E=3.2e-12

Best Hits

KEGG orthology group: K00245, fumarate reductase iron-sulfur protein [EC: 1.3.99.1] (inferred from 77% identity to har:HEAR3327)

Predicted SEED Role

"Succinate dehydrogenase iron-sulfur protein (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4XZB2 at UniProt or InterPro

Protein Sequence (237 amino acids)

>RR42_RS02215 fumarate reductase (Cupriavidus basilensis FW507-4G11)
MTTLNVRVWRGNEDGQFASYQVPRSASQTVLDVVTYIQRHLEPDLGYRFACRVGMCGSCA
MTVNGKARWSCRTHVAKVVQGDALEIAPLSNLPVIKDLATDMTAFFDKWAAAKGQFKGAA
TRHDAFASVEPASPARKAADAGIECIGCGVCYASCDVVGWRPDYLGPAAMNRAWTLVNDV
RDVVGTERLRAVAGDAGCHSCHTQGSCTERCPKQLAPTAGIAGLKRIVAKAAIKGEL