Protein Info for RR42_RS02130 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 41 to 59 (19 residues), see Phobius details amino acids 65 to 92 (28 residues), see Phobius details amino acids 95 to 100 (6 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 175 to 199 (25 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 244 to 266 (23 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details TIGR00704: Na/Pi-cotransporter II-related protein" amino acids 1 to 306 (306 residues), 272.1 bits, see alignment E=4.1e-85 PF02690: Na_Pi_cotrans" amino acids 13 to 148 (136 residues), 124.2 bits, see alignment E=4e-40 amino acids 160 to 237 (78 residues), 38.9 bits, see alignment E=8.5e-14 PF01895: PhoU" amino acids 340 to 425 (86 residues), 51.3 bits, see alignment E=1.3e-17 amino acids 445 to 521 (77 residues), 25.8 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 90% identity to reu:Reut_A0365)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4J8 at UniProt or InterPro

Protein Sequence (561 amino acids)

>RR42_RS02130 membrane protein (Cupriavidus basilensis FW507-4G11)
MGVLLHLLSGVALLVWGTNIVKVGILRVYGANLRHVLSSSISNRFTAFAAGLGVTGLVQS
SNATAVIVSSFVGQGLIAVAPALAIMLGANVGTAIMVQVFSLDLSWLSPLLIFVGVILHL
SWKGNKPGHVGRVLIGLGLITLALELISIATRPVVEAAGVKVLFGTLTGDPTLDMLIGAL
LTILCYSSLAVVLFCGALASAGVVSLHVAMALVLGANLGSGISALLTTSGNNQPGKRVTL
GNLLSRLLGCVIALPLLGQAEHLLALVDADPQRLVVNFHLLFNVALAVLLLGATGPLARL
CEAVLPGRNTGDSQVTPRHLDPAALPTPALALSNAAREVLRIGDRIEQMLDNMLRVLRTN
DAKLATATCRIDDEVDDLYTAIKLYLTRISLEALDERDGRRWTEIISLTINLEHAGDIIE
RILQDAREKKIAHNLAFSEAGMQEISQMHARVVANLRLGLSVFLSGDLKSAQQLMAEKAT
FREMERQYARTHLQRIAVQTAESIETSSLHLDVISDLKRLNSLFCATAYTVLEEAGVLNR
SRMKEDDGEPPARAVPSAQAH