Protein Info for RR42_RS02110 in Cupriavidus basilensis FW507-4G11

Annotation: potassium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 31 to 48 (18 residues), see Phobius details amino acids 56 to 73 (18 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 220 to 236 (17 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details amino acids 296 to 319 (24 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 8 to 376 (369 residues), 224.6 bits, see alignment E=3e-70 TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 12 to 287 (276 residues), 242.3 bits, see alignment E=3.5e-76 PF02254: TrkA_N" amino acids 414 to 526 (113 residues), 87.2 bits, see alignment E=1.6e-28 PF02080: TrkA_C" amino acids 588 to 655 (68 residues), 44.3 bits, see alignment E=2e-15

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 93% identity to cti:RALTA_A0336)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefB" in subsystem Glutathione-regulated potassium-efflux system and associated functions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YB85 at UniProt or InterPro

Protein Sequence (659 amino acids)

>RR42_RS02110 potassium transporter (Cupriavidus basilensis FW507-4G11)
MHSPLDLTLVLLAAAVFGVVAFRMLQLPPMLGYLVVGILIGPHALGLASDTAQTKYLAEF
GVVFLMFSIGLEFSLSKLKAMKRQVFGLGGSQVVLSLLAVIPASWAFNWLFPLSWQASVA
LGGALAMSSTAIVSKMLSERLELESEHGRNIISILLFQDLAVVPLLIVIPALSRDPGDLM
MALGLATVKIVAALSLIFFVGQRLVSRWLHIVAARRSQELFMLNLLLVTLGMAALTERLG
LSMALGAFMAGMLISETPYRHQVEEDIKPFRDVLLGLFFVTIGMLLNIHVVLDHLWLVLA
LLVVPIVFKLVLISGLARLFGSRQGVAIRTGLGLAQAGEFGFVLLNQIDGLNLVDPVLIQ
VILASMLLSMLAAPFLIQYSDAIVLRFTANEWLMQSLNMTRIAVQSLQTEKHAIICGFGR
SGQNLAHMLEREGITYVALDLDPDRVREAAGAGDTVVYGDAGRREALIAAGLHRAAALVI
TYNNTPSALKVLHHVQELQPALPVIVRTMDDSELDILQKAGATEVVPESIEGSLMLASHA
LVLLGVPMRRVVRGVQEARDARYSLLRGYFHGRDDEEDMVERESVRLHSISLGPEATSVG
RRLGALGLDRIGVEVTAVRRRGIRAFDPEPDTVLEPGDIVVLRGQPEALEAAEARMLAG