Protein Info for RR42_RS02030 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03550: LolB" amino acids 40 to 201 (162 residues), 133.2 bits, see alignment E=4.1e-43 TIGR00548: outer membrane lipoprotein LolB" amino acids 55 to 168 (114 residues), 64.4 bits, see alignment E=5.2e-22

Best Hits

Swiss-Prot: 74% identical to LOLB_CUPTR: Outer-membrane lipoprotein LolB (lolB) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K02494, outer membrane lipoprotein LolB (inferred from 74% identity to cti:RALTA_A0319)

Predicted SEED Role

"Outer membrane lipoprotein LolB precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4XZ78 at UniProt or InterPro

Protein Sequence (206 amino acids)

>RR42_RS02030 membrane protein (Cupriavidus basilensis FW507-4G11)
MPTSRRLALLCLSAPLWLAACASITPTRQFDAGETAQARDLSGRFAASYVRYGRDEGVQG
SFQWHEQGRNVRLDLISPLGQTLAVVTSTPSGATLDLPNQPPRNAPEVDTLLEEALGFSL
PVAGLRDWLHARPAPDSPARTTRDDSGRLATLAQNGWTVRYVAWQETAPTTPSTPAVASP
RRIDLARDGAANPLSVRLVINPEQAQ