Protein Info for RR42_RS01930 in Cupriavidus basilensis FW507-4G11

Annotation: RNA polymerase factor sigma-32

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 TIGR02392: alternative sigma factor RpoH" amino acids 35 to 306 (272 residues), 408.7 bits, see alignment E=1.3e-126 PF00140: Sigma70_r1_2" amino acids 37 to 66 (30 residues), 33.1 bits, see alignment (E = 6.7e-12) TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 69 to 304 (236 residues), 114.4 bits, see alignment E=4.3e-37 PF04542: Sigma70_r2" amino acids 74 to 143 (70 residues), 73.2 bits, see alignment E=1.7e-24 PF04545: Sigma70_r4" amino acids 247 to 302 (56 residues), 51.9 bits, see alignment E=6.3e-18

Best Hits

Swiss-Prot: 55% identical to RPOH_HAEIN: RNA polymerase sigma factor RpoH (rpoH) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03089, RNA polymerase sigma-32 factor (inferred from 91% identity to reh:H16_A0354)

MetaCyc: 54% identical to RNA polymerase sigma factor RpoH (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4P3 at UniProt or InterPro

Protein Sequence (309 amino acids)

>RR42_RS01930 RNA polymerase factor sigma-32 (Cupriavidus basilensis FW507-4G11)
MNAVLSADQTQMTNRLPAVPQGAGTFALTFPGTLGNIDSYIQAVHRIPLLTPEEEQRLAR
ELREHDSVDAARRMVLSHLRLVVSIARQYLGYGLPHADLIQEGNIGLMKAVKRFDPDQGV
RLVSYAMHWIKAEIHEYVLKNWRMVKVATTKAQRKLFFNLRSHKQGAHTFTPEQIDAVAR
ELNVKPEEVMEMETRLSGGDLALEGQIDDGEEDFAPIAYLADNHNEPTRVIEAQRHDRLQ
VQGLEEALSKLDERSRRIIEARWLQVNDDGSGGSTLHELADEFGVSAERIRQIETAAMKK
MKGALQAFA