Protein Info for RR42_RS01825 in Cupriavidus basilensis FW507-4G11

Annotation: phosphoglyceromutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01258: phosphoglycerate mutase 1 family
  • amino acids 3 to 246 (244 residues), 382.9 bits, E=3e-119
• PF00300: His_Phos_1
  • amino acids 4 to 125 (122 residues), 98.2 bits, E=2.6e-32
  • amino acids 141 to 219 (79 residues), 23.9 bits, E=1.5e-09

Best Hits

Swiss-Prot: 92% identical to GPMA_CUPNJ: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (gpmA) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 92% identity to reu:Reut_A0304)

MetaCyc: 62% identical to 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (Escherichia coli K-12 substr. MG1655)
RXN-15513 [EC: 5.4.2.11]

Predicted SEED Role

"Phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• gluconeogenesis III (11/12 steps found)
• homolactic fermentation (11/12 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• Bifidobacterium shunt (13/15 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• heterolactic fermentation (15/18 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• gluconeogenesis I (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• Rubisco shunt (8/10 steps found)
• formaldehyde assimilation I (serine pathway) (10/13 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• glycolysis IV (7/10 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (6/9 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• photorespiration II (6/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• superpathway of N-acetylneuraminate degradation (14/22 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• glycerol degradation to butanol (9/16 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1 or 5.4.2.11

Sequence Analysis Tools

See A0A0C4YB44 at UniProt or InterPro

Protein Sequence (248 amino acids)

>RR42_RS01825 phosphoglyceromutase (Cupriavidus basilensis FW507-4G11)
MYKLVLIRHGESTWNLENRFTGWVDVDLTDTGVAQAKLGGKLLREAGLAFDVAYTSVLKR
AIRTLWHVQDEMDLMWIPVRNEWRLNERHYGSLSGLNKAETAARFGNEQVLVWRRSYDTP
PPALEANDPRAAYDDPRYAQVPREQIPLTECLKDTVERVLPLWNESIAPDIKAGKRVVIA
AHGNSIRALVKYLDQISDDDIVGINIPNGTPLVYELDADLRPLRHYYLGDQEAIAASLAA
VANQGKAN