Protein Info for RR42_RS01815 in Cupriavidus basilensis FW507-4G11

Annotation: molybdopterin biosynthesis protein MoeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00899: ThiF
  • amino acids 9 to 244 (236 residues), 231.2 bits, E=8.9e-73
• PF03435: Sacchrp_dh_NADP
  • amino acids 32 to 148 (117 residues), 25.9 bits, E=1.1e-09

Best Hits

Swiss-Prot: 49% identical to MOEB_ECOLI: Molybdopterin-synthase adenylyltransferase (moeB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 86% identity to reh:H16_A0330)

MetaCyc: 49% identical to molybdopterin-synthase adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11361 [EC: 2.7.7.80]

Predicted SEED Role

"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• molybdopterin biosynthesis (4/6 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.80

Sequence Analysis Tools

See A0A0C4Y6N4 at UniProt or InterPro

Protein Sequence (255 amino acids)

>RR42_RS01815 molybdopterin biosynthesis protein MoeB (Cupriavidus basilensis FW507-4G11)
MNDDQLLRYSRHILLDELGIEGQSRLLASHALVIGAGGLGAAALPYLASAGVGTITVVDD
DVVDLTNLQRQVIHTTANVGRPKVESAREGMLRINPGIDVRLVQARVGAAELAHLVADAD
VVLDCCDNFDTRQAVNRACVQHSVPLVSGAALRFDGQISVFDHRQPGAPCYACLFPPSQP
AQEVACATMGVFAPLVGMVGTVQAAEALKLLMGVGTTLAGRLLMVDALGMEWTTMRLARV
ADCEVCGGAHAQAAP