Protein Info for RR42_RS01805 in Cupriavidus basilensis FW507-4G11

Annotation: selenophosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR00476: selenide, water dikinase" amino acids 6 to 322 (317 residues), 434.6 bits, see alignment E=1e-134 PF00586: AIRS" amino acids 49 to 159 (111 residues), 92.7 bits, see alignment E=2.1e-30 PF02769: AIRS_C" amino acids 172 to 354 (183 residues), 68.5 bits, see alignment E=7.8e-23

Best Hits

Swiss-Prot: 77% identical to SELD_PSEAE: Selenide, water dikinase (selD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01008, selenide, water dikinase [EC: 2.7.9.3] (inferred from 82% identity to reu:Reut_A0300)

MetaCyc: 66% identical to selenide, water dikinase (Escherichia coli K-12 substr. MG1655)
Selenide, water dikinase. [EC: 2.7.9.3]

Predicted SEED Role

"Selenide,water dikinase (EC 2.7.9.3)" in subsystem Selenocysteine metabolism (EC 2.7.9.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.9.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4XZ34 at UniProt or InterPro

Protein Sequence (355 amino acids)

>RR42_RS01805 selenophosphate synthase (Cupriavidus basilensis FW507-4G11)
MADPIRLTQYSHGAGCGCKISPQVLDVILAGSGNQHLDPRLWVGNASRDDAAVYALDGLE
EGRGVVSTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGDPLLAIAILGWPVKLLPPEVA
REVVAGGRRACEEAGIPLAGGHSIDAPEPIFGLAVTGVVDRAHLKRNDTATAGCRLYLTK
PLGIGVLTTAEKQGKLRTEDIHLARDWMCVLNRPGSRFGKLAGVRAMTDVTGFGLLGHLV
EMADGSRLTARLDHAAVPLLPEVLRYVEAGCVPGGTQRNFDSYGARIGAGINNRGGALSE
VQRALLCDPQTSGGLLVAVEPAGEAGFHAACAEFGLALAPVGEFVEQGRYAVEVI