Protein Info for RR42_RS01795 in Cupriavidus basilensis FW507-4G11

Annotation: phosphoenolpyruvate-protein phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 transmembrane" amino acids 449 to 466 (18 residues), see Phobius details TIGR01417: phosphoenolpyruvate-protein phosphotransferase" amino acids 5 to 585 (581 residues), 531.1 bits, see alignment E=1.5e-163 PF05524: PEP-utilisers_N" amino acids 6 to 129 (124 residues), 112 bits, see alignment E=3e-36 PF00391: PEP-utilizers" amino acids 168 to 239 (72 residues), 84.1 bits, see alignment E=6.7e-28 PF02896: PEP-utilizers_C" amino acids 265 to 564 (300 residues), 383.9 bits, see alignment E=7e-119

Best Hits

Swiss-Prot: 90% identical to PT1_CUPNH: Phosphoenolpyruvate-protein phosphotransferase (phbI) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K08483, phosphotransferase system, enzyme I, PtsI [EC: 2.7.3.9] (inferred from 90% identity to reu:Reut_A0297)

Predicted SEED Role

"Phosphoenolpyruvate-protein phosphotransferase of PTS system (EC 2.7.3.9)" in subsystem Fructose and Mannose Inducible PTS or Fructose utilization or Mannitol Utilization (EC 2.7.3.9)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y6N0 at UniProt or InterPro

Protein Sequence (591 amino acids)

>RR42_RS01795 phosphoenolpyruvate-protein phosphotransferase (Cupriavidus basilensis FW507-4G11)
MPFALHGIPVSRGVAIGRAHLLAPAALDVSHYLVDEDRLDAEVERLRSARAAVRAELVTL
KRDLPREAPEELGAFLDVHAMILDDEALAREPEALIRNRRYNAEWALTTRLEELMRQFDE
IEDEYLRERKADIRQVVERILKVLAGAAVLAPAPVPPSSLAPDGEPAPGVIVVAHDISPA
DMLQFRHTVFHGFVTDLGGRTSHTAIVARSLDIPAAVGVQSASELIRQDDWVIIDGDAGL
VIVDPSAIILEEYRHRQSERALEKKRLQRLRHTPAVTLDGLEIDLLANIEMAEDATAALT
AGAVGVGLFRSEFLFMNRRGELPDEEEQFEAYRGAVDAMHGLPVTIRTIDIGADKPLDGR
DGRDGRGDDFETALNPALGLRAIRWSLSEPAMFLTQLRALLRASAFGPVRLLIPMLAHAR
EIDQTLDLIAQAKRQLDARGQAFDPNIKVGAMIEIPAAVLMLPLFLRRMDFLSIGTNDLI
QYTLAIDRADNAVAHLYDPLHPAVLQLIARTIREANRAGVPVAVCGEMAGDPAMTRLLLG
MGLREFSMHPSQLLRVKQEVLHADCERLERLVEQVLSAYEPEELACALKLL