Protein Info for RR42_RS01735 in Cupriavidus basilensis FW507-4G11

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 42 to 65 (24 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 197 to 213 (17 residues), see Phobius details PF01810: LysE" amino acids 15 to 210 (196 residues), 114.1 bits, see alignment E=3.1e-37

Best Hits

Swiss-Prot: 39% identical to RHTB_ECO57: Homoserine/homoserine lactone efflux protein (rhtB) from Escherichia coli O157:H7

KEGG orthology group: K05834, homoserine/homoserine lactone efflux protein (inferred from 84% identity to reu:Reut_A0287)

MetaCyc: 39% identical to L-homoserine/L-homoserine lactone/L-threonine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-242; TRANS-RXN-242A; TRANS-RXN0-0244

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4XZ21 at UniProt or InterPro

Protein Sequence (217 amino acids)

>RR42_RS01735 lysine transporter LysE (Cupriavidus basilensis FW507-4G11)
MRWDVWLAYFAACWVIAVSPGAGAVLSMSHGLSYGLRKTTTTIFGLQTGLVIILLVAGGG
LGALLVASEHAFAVVKTIGALYLIYIGVQQWRARVDGGAQDDAARGTEAPRVAALSPRRR
FATGLLTNVTNPKGIIFMVAVLPQFIDPAHALGPQLAILAATMCGVDLVVMHGYALLASR
MRGLFRNARAVRWQNRIFGSVLVAVGAALFFVRRHPA