Protein Info for RR42_RS01670 in Cupriavidus basilensis FW507-4G11

Annotation: 23S rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 PF17785: PUA_3" amino acids 4 to 67 (64 residues), 76.5 bits, see alignment E=4e-25 PF02475: Met_10" amino acids 134 to 271 (138 residues), 24 bits, see alignment E=1.1e-08 PF10672: Methyltrans_SAM" amino acids 174 to 352 (179 residues), 101.3 bits, see alignment E=2.1e-32 PF03602: Cons_hypoth95" amino acids 221 to 306 (86 residues), 32.3 bits, see alignment E=2.8e-11 PF13847: Methyltransf_31" amino acids 222 to 350 (129 residues), 27.8 bits, see alignment E=6.9e-10 PF09445: Methyltransf_15" amino acids 224 to 305 (82 residues), 22.3 bits, see alignment E=3e-08

Best Hits

Swiss-Prot: 51% identical to RLMI_SHEAM: Ribosomal RNA large subunit methyltransferase I (rlmI) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 91% identity to rme:Rmet_0223)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4K7 at UniProt or InterPro

Protein Sequence (397 amino acids)

>RR42_RS01670 23S rRNA methyltransferase (Cupriavidus basilensis FW507-4G11)
MNTITLKPGKEKSLLRRHPWVYATGVDTVEGRCEPGSTVIVRAADGRFLARGAYSPSSQI
RVRVWSFDENEPVDHAMFKRRVSSALAHRKQWVKDSDAVRLIFGESDRLPGLIVDYYGSG
ANGQLVCQFNAAGVEAWKDALVQALVKETGCPNVYERSDAAVREREGLPLVTGVLAGAEP
DPELNVTEHGVRYYVDVKSGHKTGFYVDQRDNRKLVGDLANGREVLNCFCYTGGFSLAAL
RGGATSVTSIDSSGEALKTAAGNVTLNGFDPERATWLDADVFKSLRQFRADGRQFDLIVL
DPPKFAPSAQHIDRAARAYKEINLVGLQLLRPGGLLFTYSCSGAISMELFQKIVAGAATD
ARADARILRRLSAGTDHPMLAAFPEGEYLKGLLLEKI