Protein Info for RR42_RS01645 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 36 to 404 (369 residues), 150.1 bits, see alignment E=6.6e-48

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 89% identity to rme:Rmet_0218)

Predicted SEED Role

"Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4K3 at UniProt or InterPro

Protein Sequence (444 amino acids)

>RR42_RS01645 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MTILIRNLQRIALAMGASAALLAPLAVQAQSGEQFVALPSYRVGPYGANGQSFYGGFVDY
LNYVNLKDGGVNGVKLSWEECETEYNNAKGVECYERLKGKSPMSKGTAYHTMSTGISYAL
VDKTAGDKVPLVMMGYGRTDAVDGSVFPYAFPLVTTYQMQVSAIVKFLAGKNGGSLAGKK
IVYLYHDSAYGKEPIVALEAEAKLGKFNLVEIPVAHPGNEQGAQWLKIRQENPDYVIFWG
WGVMNQTALKAAQKVGFARDKMIGSWWAGSEEDTVPAGDAAKGYMSATWNVAGRGVSLIA
DIDKVVYGAGKGNMQDRNKVGSVLYNRGVSAAVVTVEAIRVAQARYGKGKVMSGEDMRWA
FENLNVNNARLQQLGATGLLPEIKTSCDNHEGSGKVKIQQWDGTKWVVVSDWIEGNKNLI
HPLFKASAAQFAKEKGISPACMKS