Protein Info for RR42_RS01500 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00369: uncharacterized domain 1
  • amino acids 20 to 135 (116 residues), 133 bits, E=2.6e-43
• PF03061: 4HBT
  • amino acids 50 to 128 (79 residues), 66.3 bits, E=1.3e-22

Best Hits

Swiss-Prot: 58% identical to Y3380_VIBCH: Putative esterase VC_A0580 (VC_A0580) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 60% identity to xcv:XCV0179)

MetaCyc: 52% identical to 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (Escherichia coli K-12 substr. MG1655)
RXN-9311 [EC: 3.1.2.28]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of chorismate metabolism (45/59 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (3/7 steps found)
• superpathway of menaquinol-8 biosynthesis I (5/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (4/9 steps found)
• superpathway of menaquinol-10 biosynthesis (4/10 steps found)
• superpathway of menaquinol-11 biosynthesis (4/10 steps found)
• superpathway of menaquinol-12 biosynthesis (4/10 steps found)
• superpathway of menaquinol-13 biosynthesis (4/10 steps found)
• superpathway of menaquinol-6 biosynthesis (4/10 steps found)
• superpathway of menaquinol-7 biosynthesis (4/10 steps found)
• superpathway of menaquinol-9 biosynthesis (4/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (3/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (3/9 steps found)
• superpathway of phylloquinol biosynthesis (4/15 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.28

Sequence Analysis Tools

See A0A0C4Y4I0 at UniProt or InterPro

Protein Sequence (139 amino acids)

>RR42_RS01500 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MLWKSPPSLKDLQARHKDTAVEQLGIEFTEIGEASLSARMPVDRRTVQPHGILHGGASVL
LAETLGSCAASLCLDSETQYCVGLDINANHVRAARTGFVTGTATPVHIGRTTHVWAIEIR
NEEGKMVCVSRITMSILSR