Protein Info for RR42_RS01270 in Cupriavidus basilensis FW507-4G11
Annotation: 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 83% identity to reu:Reut_A0202)Predicted SEED Role
"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)
MetaCyc Pathways
- aspartate superpathway (23/25 steps found)
- S-adenosyl-L-methionine salvage II (3/3 steps found)
- superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
- S-adenosyl-L-methionine biosynthesis (1/1 steps found)
- S-adenosyl-L-methionine salvage I (3/4 steps found)
- L-methionine degradation I (to L-homocysteine) (2/3 steps found)
- ethene biosynthesis I (plants) (1/3 steps found)
- superpathway of L-cysteine biosynthesis (mammalian) (2/5 steps found)
- 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
- L-cysteine biosynthesis VI (reverse transsulfuration) (3/7 steps found)
- superpathway of L-methionine salvage and degradation (7/16 steps found)
- L-methionine salvage cycle I (bacteria and plants) (4/12 steps found)
- L-methionine salvage cycle III (3/11 steps found)
- L-methionine salvage cycle II (plants) (2/11 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.5.1.6
Use Curated BLAST to search for 2.5.1.6
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C4Y475 at UniProt or InterPro
Protein Sequence (291 amino acids)
>RR42_RS01270 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase (Cupriavidus basilensis FW507-4G11) MIRPQPYTEWAPQLDAGTKAGLRRELEQGAVLFFPQLRFQFEPGEERFLDSRWSDGKSKN INLRANDQAVRGATGGEQDLKDLYVLIRRYAEYSEKLVLSLFPEYGPHMVRAGTSLRPSE IAGRPVSWRKDDTRLHVDAFPSNPMLGQRLLRVFHNIDPQAPRVWRVGEPFGDFAKRFVP KTKGMWPGQARVMEMLHITKRRRSEYDHRMLQLHDLAKADLEYQANVPQQEFQFPPGSTW IVFSDQVLHAAMRGRAMMEQTYYLSPKAISDHTHSPEAVLARMLGRPMVVG