Protein Info for RR42_RS01160 in Cupriavidus basilensis FW507-4G11

Annotation: homoserine O-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 TIGR01392: homoserine O-acetyltransferase" amino acids 29 to 380 (352 residues), 464.4 bits, see alignment E=1.2e-143 PF00561: Abhydrolase_1" amino acids 59 to 368 (310 residues), 78.4 bits, see alignment E=3.4e-26

Best Hits

Swiss-Prot: 93% identical to METXS_CUPNJ: Homoserine O-succinyltransferase (metXS) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K00641, homoserine O-acetyltransferase [EC: 2.3.1.31] (inferred from 93% identity to reu:Reut_A0186)

Predicted SEED Role

"Homoserine O-acetyltransferase (EC 2.3.1.31)" in subsystem Methionine Biosynthesis (EC 2.3.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4C9 at UniProt or InterPro

Protein Sequence (390 amino acids)

>RR42_RS01160 homoserine O-acetyltransferase (Cupriavidus basilensis FW507-4G11)
MTDVAPPPAALALPTDSVGIVAPQCMHFTEPLKLRNGTSLADYDLMVETYGTLNAARSNA
VLVCHALNASHHVAGVYEHDPRDVGWWDNMVGPGKPLDTDRFFVIGVNNLGSCFGSTGPM
SANPATGQPYGATFPVVTVEDWVNAQARVADRFGITQFAAVMGGSLGGMQALAWSLMYPD
RLRHCIVVASTPKLSAQNIAFNEVARSAILSDPDFHGGNYYAHGVKPKRGLRVARMIGHI
TYLSDEDMAEKFGRELKTDDIRFSFDVEFQVESYLRYQGDKFAEYFDANTYLLITRALDY
FDPALAFGGDLTRAVSQTQASFLVASFTTDWRFAPNRSRELVKALLDNKRPVSYAEIDAP
HGHDAFLLDDPRYHNLMRAYYERIAEEIGA