Protein Info for RR42_RS01050 in Cupriavidus basilensis FW507-4G11

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF00561: Abhydrolase_1" amino acids 34 to 255 (222 residues), 101.2 bits, see alignment E=7.7e-33 PF12697: Abhydrolase_6" amino acids 36 to 289 (254 residues), 53.1 bits, see alignment E=7e-18

Best Hits

Swiss-Prot: 47% identical to DEHA_RHOPA: Fluoroacetate dehalogenase (RPA1163) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K01561, haloacetate dehalogenase [EC: 3.8.1.3] (inferred from 87% identity to cti:RALTA_A0140)

MetaCyc: 43% identical to fluoroacetate dehalogenase monomer (Moraxella sp. B)
Haloacetate dehalogenase. [EC: 3.8.1.3]

Predicted SEED Role

"Alpha/beta hydrolase fold (EC 3.8.1.5)" (EC 3.8.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.8.1.3

Use Curated BLAST to search for 3.8.1.3 or 3.8.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y433 at UniProt or InterPro

Protein Sequence (299 amino acids)

>RR42_RS01050 alpha/beta hydrolase (Cupriavidus basilensis FW507-4G11)
MQNDASALLFPNFEPFRLHIGDVGIAGVRGGSGPPLLLLHGHPQSHLIWHKVAPALADRF
TVIATDLRGYGSSSAPPGKAGFETYSKRTMAQDQVAVMAQLGFDRFALCAHDRGARVAHR
LIADHPGRVTRAMLLDIAPTLAMYERTSMAFAAAYWHWFFLIQPAPFPETLINAEPEFYL
NKLMGLRHAGLSPFAPEAMAAYTAAMRDPAHVHAMCEDYRAAATIDLDHDRADRADGRRL
ACPLRVLWGEHGVVARCFEPLSLWQEVASEVSGRAVPCGHYIPEEAPAVLQEEMLGFFC