Protein Info for RR42_RS00770 in Cupriavidus basilensis FW507-4G11

Annotation: 5-methyltetrahydrofolate--homocysteine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF02574: S-methyl_trans" amino acids 31 to 339 (309 residues), 321.2 bits, see alignment E=4.5e-100

Best Hits

KEGG orthology group: K00548, 5-methyltetrahydrofolate--homocysteine methyltransferase [EC: 2.1.1.13] (inferred from 93% identity to cti:RALTA_A0093)

Predicted SEED Role

"5-methyltetrahydrofolate--homocysteine methyltransferase (EC 2.1.1.13)" in subsystem Methionine Biosynthesis (EC 2.1.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.13

Use Curated BLAST to search for 2.1.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4XYL7 at UniProt or InterPro

Protein Sequence (355 amino acids)

>RR42_RS00770 5-methyltetrahydrofolate--homocysteine methyltransferase (Cupriavidus basilensis FW507-4G11)
MSAAPRSASLPPARPYTRAANLPALLRERILILDGAMGTMIQRYKLTEADYRGERFAGHH
VDVKGNNELLLLSRPQVISEIHEQYLAAGADLIETNTFGATGVAQEDYKMADLAYEMNVV
AARLAREACDKYSTPDKPRFVAGAFGPTPKTASISPDVNDPGARNVTFEELRCSYYEQGK
GLLEGGADVFLVETIFDTLNAKAALFAIDQLFEDTGERLPVMISGTVTDASGRILSGQTV
EAFWNSLRHARPITFGLNCALGATLMRPYIAELAKICDAAVSCYPNAGLPNPMSDTGFDE
TPEVTSSLVEEFAASGLVNLVGGCCGTTPEHIAAIAERVASKKPRTWPGQYRDAA