Protein Info for RR42_RS00710 in Cupriavidus basilensis FW507-4G11

Annotation: ADP-heptose synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02199: bifunctional protein RfaE, domain II
  • amino acids 22 to 159 (138 residues), 198 bits, E=6.5e-63
• TIGR00125: cytidyltransferase-like domain
  • amino acids 29 to 94 (66 residues), 45.2 bits, E=8.5e-16
• PF01467: CTP_transf_like
  • amino acids 30 to 133 (104 residues), 68.6 bits, E=3.3e-23

Best Hits

Swiss-Prot: 70% identical to HEPPA_BORBR: D-beta-D-heptose 1-phosphate adenylyltransferase (BB4463) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: None (inferred from 89% identity to reh:H16_A0138)

MetaCyc: 47% identical to glycerol-3-phosphate cytidylyltransferase (Aquifex aeolicus)
Glycerol-3-phosphate cytidylyltransferase. [EC: 2.7.7.39]

Predicted SEED Role

"Glycerol-3-phosphate cytidylyltransferase (EC 2.7.7.39)" in subsystem Rhamnose containing glycans (EC 2.7.7.39)

MetaCyc Pathways

• 1-(sn-glycero-1-phospho)-1D-myo-inositol biosynthesis (1/3 steps found)
• 1-(sn-glycero-3-phospho)-1D-myo-inositol biosynthesis (1/3 steps found)
• lipid A-core biosynthesis (P. gingivalis) (1/7 steps found)
• poly(3-O-β-D-glucopyranosyl-N-acetylgalactosamine 1-phosphate) wall teichoic acid biosynthesis (2/10 steps found)
• poly(glycerol phosphate) wall teichoic acid biosynthesis (2/11 steps found)
• poly(ribitol phosphate) wall teichoic acid biosynthesis I (B. subtilis) (2/12 steps found)
• poly(ribitol phosphate) wall teichoic acid biosynthesis II (S. aureus) (2/14 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.39

Sequence Analysis Tools

See A0A0C4Y626 at UniProt or InterPro

Protein Sequence (162 amino acids)

>RR42_RS00710 ADP-heptose synthase (Cupriavidus basilensis FW507-4G11)
MSTFESKLVPPDNPTALAEKLAPLPRPLVFTNGVFDILHRGHATYLAQAKALGASLVVGV
NSDASVRMLGKGDDRPLNHESDRMALIAALASVDLVVMFREKTPVELIRLVRPDIYVKGG
DYDIDTLEETRLVRSWGGQAHAIAFLHDRSTTKLLSKVRQGS