Protein Info for RR42_RS00710 in Cupriavidus basilensis FW507-4G11
Annotation: ADP-heptose synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 70% identical to HEPPA_BORBR: D-beta-D-heptose 1-phosphate adenylyltransferase (BB4463) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
KEGG orthology group: None (inferred from 89% identity to reh:H16_A0138)MetaCyc: 47% identical to glycerol-3-phosphate cytidylyltransferase (Aquifex aeolicus)
Glycerol-3-phosphate cytidylyltransferase. [EC: 2.7.7.39]
Predicted SEED Role
"Glycerol-3-phosphate cytidylyltransferase (EC 2.7.7.39)" in subsystem Rhamnose containing glycans (EC 2.7.7.39)
MetaCyc Pathways
- 1-(sn-glycero-1-phospho)-1D-myo-inositol biosynthesis (1/3 steps found)
- 1-(sn-glycero-3-phospho)-1D-myo-inositol biosynthesis (1/3 steps found)
- lipid A-core biosynthesis (P. gingivalis) (1/7 steps found)
- poly(3-O-β-D-glucopyranosyl-N-acetylgalactosamine 1-phosphate) wall teichoic acid biosynthesis (2/10 steps found)
- poly(glycerol phosphate) wall teichoic acid biosynthesis (2/11 steps found)
- poly(ribitol phosphate) wall teichoic acid biosynthesis I (B. subtilis) (2/12 steps found)
- poly(ribitol phosphate) wall teichoic acid biosynthesis II (S. aureus) (2/14 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.7.39
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C4Y626 at UniProt or InterPro
Protein Sequence (162 amino acids)
>RR42_RS00710 ADP-heptose synthase (Cupriavidus basilensis FW507-4G11) MSTFESKLVPPDNPTALAEKLAPLPRPLVFTNGVFDILHRGHATYLAQAKALGASLVVGV NSDASVRMLGKGDDRPLNHESDRMALIAALASVDLVVMFREKTPVELIRLVRPDIYVKGG DYDIDTLEETRLVRSWGGQAHAIAFLHDRSTTKLLSKVRQGS