Protein Info for RR42_RS00585 in Cupriavidus basilensis FW507-4G11

Annotation: glutamyl-tRNA amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 86% identical to GATC_CUPTR: Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (gatC) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K02435, aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C [EC: 6.3.5.6 6.3.5.7] (inferred from 86% identity to cti:RALTA_A0052)

Predicted SEED Role

"Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)" (EC 6.3.5.6, EC 6.3.5.7)

MetaCyc Pathways

L-glutamate and L-glutamine biosynthesis (7/7 steps found)
L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
ammonia assimilation cycle III (3/3 steps found)
L-glutamate biosynthesis I (2/2 steps found)
L-glutamine degradation I (1/1 steps found)
L-citrulline biosynthesis (6/8 steps found)
glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.6, 6.3.5.7

Use Curated BLAST to search for 6.3.5.6 or 6.3.5.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4XYJ2 at UniProt or InterPro

Protein Sequence (99 amino acids)

>RR42_RS00585 glutamyl-tRNA amidotransferase (Cupriavidus basilensis FW507-4G11)
MALDLSDVKRIAHLARIEINDDEAGQTLVQLNQFFSLVEQMQAVDTTGIVPLAHPLSAVR
EMSQRLRDDVVTEPNRREDYQRPAPATEGGLYLVPKVIE