Protein Info for RR42_RS00575 in Cupriavidus basilensis FW507-4G11

Annotation: rod shape-determining protein MreC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details TIGR00219: rod shape-determining protein MreC" amino acids 9 to 275 (267 residues), 165.8 bits, see alignment E=6.1e-53 PF04085: MreC" amino acids 128 to 273 (146 residues), 142 bits, see alignment E=6.1e-46

Best Hits

KEGG orthology group: K03570, rod shape-determining protein MreC (inferred from 86% identity to cti:RALTA_A0054)

Predicted SEED Role

"Rod shape-determining protein MreC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y3T8 at UniProt or InterPro

Protein Sequence (291 amino acids)

>RR42_RS00575 rod shape-determining protein MreC (Cupriavidus basilensis FW507-4G11)
MDYTPPPLFKQGTSAVARLVFYVTIALALLIVDARFDALRVVRQVAATVLMPVERTVLVP
RDALRATFDYAQSSAALASENRDLKRRMVTEAEGSVRQSQLEAENNQLRKLLGLVQQSAT
PVTAAEILYDARDPYSQRIVIDRGSQHGLRAGYPVIDERGVIGQITRVSPFQSEVTLLTD
KEQAIPVQVVRNGLRSVAFGGARAGLLDLRFMAASADLQQGDLLVTSGLDGTYPPGLPVA
KIVQIERKADTAFSRVYCEPVAGVRSHRQLLVIRYEAQLPPRESIDGPRDA