Protein Info for RR42_RS00515 in Cupriavidus basilensis FW507-4G11

Annotation: phosphonate monoester hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 PF00884: Sulfatase" amino acids 4 to 381 (378 residues), 148.4 bits, see alignment E=4.4e-47 PF01663: Phosphodiest" amino acids 6 to 74 (69 residues), 25 bits, see alignment E=2.1e-09 PF16347: SGSH_C" amino acids 327 to 485 (159 residues), 46.2 bits, see alignment E=8.2e-16

Best Hits

KEGG orthology group: None (inferred from 87% identity to reh:H16_B1528)

Predicted SEED Role

"Putative sulfatase (EC 3.1.6.-)" (EC 3.1.6.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.6.-

Use Curated BLAST to search for 3.1.6.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y3Z1 at UniProt or InterPro

Protein Sequence (519 amino acids)

>RR42_RS00515 phosphonate monoester hydrolase (Cupriavidus basilensis FW507-4G11)
MPTRNTLFIMCDQLRQDHLACYGHPTLRTRHIDALAARGVRFTKAFVTSGVCGPSRMSFY
TGRYPSSHGATWNRVPLSVGEVTLGEYLKDSHRALALAGKTHVMPDNANMKRLHLDGGSE
LETLLRSGHFVEVDRHDGHHAEPHSAYAEWLRKQGYDSADPWTDYVISAENAQGEIVSGW
QMRNAGLPARVAQAHSETAYTVGQAMQYIAARGDDPWVLHLSLVKPHWPYMAPAPYHAAY
ALDDCLPLKRHEAELDNPHPVLDAYRTQEECANFMRSEVSDTVRPAYQGLVQQIDDRLGE
LWEQLERLGRWEDTLIVFTADHGDFLGDHWLGEKEQFYDTVQNIPLIVYDPSAEADATRG
SADARMVSAVDVVPTVLDALGLPPADHRVEGRSLLDLTRGRGNGQWRDFVVSELDYAYRG
ARIALGRQPGECRAWMVRNARWKYVHWQGFRPQLFDLERDPDEFFDLGEDAGHEAIRSAM
RLHLLEWFCMLKPRTTVSNDEVAAKTNVYKQAGVFFGVW