Protein Info for RR42_RS00375 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 86 to 113 (28 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 312 to 334 (23 residues), see Phobius details amino acids 340 to 361 (22 residues), see Phobius details amino acids 373 to 397 (25 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 390 (365 residues), 176.1 bits, see alignment E=5.1e-56

Best Hits

KEGG orthology group: K08194, MFS transporter, ACS family, D-galactonate transporter (inferred from 90% identity to reh:H16_A0070)

Predicted SEED Role

"Probable glucarate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y5S9 at UniProt or InterPro

Protein Sequence (432 amino acids)

>RR42_RS00375 MFS transporter (Cupriavidus basilensis FW507-4G11)
MQTTSRAAALTETKSSVRWKIFLMMLFLIAINYIDRASLSVAMPLIAKEFDLSPTMQGLI
LSSFFWTYAVMQIPGGMLADKYKPRIVIATATVFWGAFQAMAAVCTSAGALLLTRLGLGA
AEAPIYPAGGKLNAIWMTQNERGRGATLLDGGAPLGAALGAIIITWLITALGSWRLAFVV
AGVGTVLAGMLAWYYVRNSPREHRGVNELEASYIEAAQASEHRAEPANLSGRSLDFLKYR
SVWCMATGWMCFNSVFYGLLTWMPNYLNKVHGFDIKQMGGASFIIFFSGFIGELIGGWIA
DKWKAAGGAPNLVMRTLFGIAAVVATVSIFSVAYVKDPVVVVALLSSTLFFLRWCGLYWC
IPSILGTRNKVGVLGGIMNLGGNIGGITVPIIVGMIVQFTGSYFLALMFFAAAGVGLLIS
STAIDYEKKLPV