Protein Info for RR42_RS00005 in Cupriavidus basilensis FW507-4G11

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 PF11638: DnaA_N" amino acids 3 to 65 (63 residues), 63 bits, see alignment E=4.2e-21 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 241 to 593 (353 residues), 518.4 bits, see alignment E=9.2e-160 PF00308: Bac_DnaA" amino acids 260 to 477 (218 residues), 289.4 bits, see alignment E=5.3e-90 PF00004: AAA" amino acids 296 to 417 (122 residues), 25.8 bits, see alignment E=3.2e-09 PF01695: IstB_IS21" amino acids 296 to 397 (102 residues), 25.3 bits, see alignment E=2.6e-09 PF08299: Bac_DnaA_C" amino acids 504 to 572 (69 residues), 107.9 bits, see alignment E=5.2e-35

Best Hits

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 81% identity to reu:Reut_A0001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YA84 at UniProt or InterPro

Protein Sequence (595 amino acids)

>RR42_RS00005 chromosomal replication initiator protein DnaA (Cupriavidus basilensis FW507-4G11)
MQDFWQAAAAQLERELTPQQFKTWIKPLAPVGFDEQAHALRIAAPNRFKLDWVKSQFSGR
ITALACEYWEANVSVHFVLDPAASGRAAAGYPQQAGQPGLPGMAAQHAGPGYPSGQPLSQ
NFGQPGMQPGQGGQGYGPMNQAGGQRGGQAPYPGNGANGSNGGNYPGSANQGNMGGMGGE
IVDIDVPQLDPAEASARSYRVQPSQQPMQGGHPGNQGGHPGHQGHPGQQSHPGQQSHQGH
PGNQHGGQQQNDSVHERSRLNHILTFDNFVTGKANQLARAAAIQVANNPGKSYNPLYLYG
GVGLGKTHLIHAIGNFMLLENPRARIRYIHAEQYVSDVVKAYQRKAFDEFKRYYHSLDLL
LIDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEISGIDDRLISRFDSGLTV
AIEPPELEMRVAILMKKAAAENVSVPEEVAFFVAKHLRSNVRELEGALRKILAFSNFHGK
DITIDVTREALKDLLTVQNRQISVENIQKTCADFYNIKVADMYSKKRPANIARPRQIAMY
LAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQLNHELHVLEQTLKG