Protein Info for RALBFv3_RS23870 in Ralstonia solanacearum IBSBF1503

Annotation: serine/threonine protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF00069: Pkinase" amino acids 12 to 279 (268 residues), 141 bits, see alignment E=4.9e-45 PF07714: PK_Tyr_Ser-Thr" amino acids 14 to 280 (267 residues), 78.6 bits, see alignment E=4.9e-26

Best Hits

KEGG orthology group: K08884, serine/threonine protein kinase, bacterial [EC: 2.7.11.1] (inferred from 62% identity to shw:Sputw3181_2210)

Predicted SEED Role

"Protein kinase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.11.1

Use Curated BLAST to search for 2.7.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>RALBFv3_RS23870 serine/threonine protein kinase (Ralstonia solanacearum IBSBF1503)
MINPGDTIGERYTVIEHVGRGGMQEVYRARDGLLEIDVALKTPQVGQSAKRFADSAVMAA
RVNNHYVAKTIDYFVDGGVAYLVEEFVDGETLEQKLERFGFLDPHLGARVLHHLAKGVAA
SHRAGVIHRDLKPSNIMGSSGVNLHNLKITDFGIATLAAEVFDEESKAGDFTRSTSGTVR
GALPYMAPEMMFRQPGEILSSAIDIWSVGALMFKLLTGDFPFGVYLDAAVNVKNRTRKPW
PAFMTEHPQFAPLARELQEIVDGCLEYEPGKRPSADELVTRCQALCYLAVEREVGAVERL
IQNGYSGFIAGDPEPIFFSMESVYGLSRPNAAKNRNVCFSSFPGAPRRRAHPVIVLKS