Protein Info for RALBFv3_RS23345 in Ralstonia solanacearum IBSBF1503

Annotation: peptide chain release factor 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 TIGR00503: peptide chain release factor 3" amino acids 1 to 529 (529 residues), 793.3 bits, see alignment E=9.3e-243 PF00009: GTP_EFTU" amino acids 10 to 278 (269 residues), 167.5 bits, see alignment E=5.3e-53 PF01926: MMR_HSR1" amino acids 14 to 145 (132 residues), 22.5 bits, see alignment E=2.1e-08 TIGR00231: small GTP-binding protein domain" amino acids 15 to 150 (136 residues), 68.3 bits, see alignment E=6.8e-23 PF03144: GTP_EFTU_D2" amino acids 316 to 381 (66 residues), 37.9 bits, see alignment E=4e-13 PF16658: RF3_C" amino acids 389 to 515 (127 residues), 152.3 bits, see alignment E=1.3e-48

Best Hits

Swiss-Prot: 98% identical to RF3_RALSO: Peptide chain release factor 3 (prfC) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02837, peptide chain release factor 3 (inferred from 98% identity to rsl:RPSI07_mp1777)

Predicted SEED Role

"Peptide chain release factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (531 amino acids)

>RALBFv3_RS23345 peptide chain release factor 3 (Ralstonia solanacearum IBSBF1503)
MSTLQQEIRRRRTFAIISHPDAGKTTLTEKLLWFGGAIQMAGAVRARKASRHATSDWMEL
EKQRGISVTSSVMQFPYRNDGGDYIVNLLDTPGHEDFSEDTYRTLTAVDSAVMVIDSVNG
VEAQTIKLLNVCRLRSTPILTFINKLDREGRAPIELLDEIENVLQIQCAPMTWPIGMGKS
FKGVYHLVNDTVQLFDPNADSEKGATAGMIQGLDNPELDRVLGSQAEELRIDIELVRGAS
HTFDQDLFLAGRQCPVYFGSAVNNFGVQSLLDALVGLSPEPLARETQTREVTPFEDKFTG
FVFKIQANMDPKHRDRIAFVRVCSGRFERGMKLLQVSTGKTVAINNAITFMAQDRNTTEE
AYAGDIIGVPNHGTIRLGDAFTEGETLKFTGIPSFAPEYFRRARLNNPLKTKQLQKGLQQ
LAEEGATQMFRPLASNDLVLGAVGTLQFDVVAHRLEHEYGVDAIFEPHECATARWLKGKP
EDIDKLIDKAGHNVAVDGAGDYVYLAPSQVNLRLTQERFPDIQFMETREVV