Protein Info for RALBFv3_RS23145 in Ralstonia solanacearum IBSBF1503

Annotation: divalent metal cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 47 to 63 (17 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 124 to 150 (27 residues), see Phobius details amino acids 158 to 175 (18 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details amino acids 319 to 345 (27 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details amino acids 430 to 452 (23 residues), see Phobius details amino acids 459 to 479 (21 residues), see Phobius details amino acids 524 to 545 (22 residues), see Phobius details PF01566: Nramp" amino acids 71 to 425 (355 residues), 279.3 bits, see alignment E=2.3e-87

Best Hits

KEGG orthology group: None (inferred from 96% identity to rsl:RPSI07_mp0032)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>RALBFv3_RS23145 divalent metal cation transporter (Ralstonia solanacearum IBSBF1503)
MTQFASGIDAPPRHAALDDAHVGDIRGALGTIAGHDIGPRRGWRARLRTLLAILGPGLIV
MVGDNDAGAFGTYTQAGQNYGTTLLWTLLLLIPVLYVNQEMVLRLGAVTRVGHARLIFAR
FGRFWGSFSVIDLFLVNALTLVTEFIGISLALEYLGIPRHWGVCASAALVLLAASTGDFR
RFERFAMALVVGSLTLIPVFVMVHPPLGHVARDFFVPALPANAPLSEVMLLIIAIVGTTV
APWQLFFQQSYVIDKRITPRFIRYERADLWLGIVLVIAGAVAMIAFSAQAFHGTPEFGQY
TDALGTAVGLEKHAGRWAGILFAIALLDASIIGACAVSLSTAYAIGDVLAVRHSLHRKPT
EAKGFYAVYFGLTLLAAGLVLTPGVPLGLLTNAVQSLAGVLLPSATVFLLLLCNDKAVLG
PWTNTRLTNLFTGAVVAVLVMLSVILTAAVLFPNIGTVEIVAVLAGGSLIAAVLSLVLWR
IERRANHGIVRHRVSVLDRTRWTMPPLEQLTAARLTPLKRTWMFVLRGYLVIAAGLVLVR
IAGLVTG