Protein Info for RALBFv3_RS22815 in Ralstonia solanacearum IBSBF1503

Annotation: propionate catabolism operon regulatory protein PrpR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 TIGR02329: propionate catabolism operon regulatory protein PrpR" amino acids 10 to 648 (639 residues), 871.9 bits, see alignment E=7.7e-267 PF06506: PrpR_N" amino acids 33 to 197 (165 residues), 166 bits, see alignment E=2.4e-52 PF00989: PAS" amino acids 203 to 249 (47 residues), 24.3 bits, see alignment 1.1e-08 PF08448: PAS_4" amino acids 208 to 254 (47 residues), 24.4 bits, see alignment 1.2e-08 PF00158: Sigma54_activat" amino acids 327 to 494 (168 residues), 232.4 bits, see alignment E=1e-72 PF14532: Sigma54_activ_2" amino acids 328 to 499 (172 residues), 70.7 bits, see alignment E=6.4e-23 PF07728: AAA_5" amino acids 351 to 470 (120 residues), 26.1 bits, see alignment E=3e-09 PF02954: HTH_8" amino acids 613 to 647 (35 residues), 32.7 bits, see alignment (E = 2e-11)

Best Hits

KEGG orthology group: K02688, transcriptional regulator, propionate catabolism operon regulatory protein (inferred from 93% identity to rso:RSp0123)

Predicted SEED Role

"Propionate catabolism operon regulatory protein PrpR" in subsystem Methylcitrate cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (649 amino acids)

>RALBFv3_RS22815 propionate catabolism operon regulatory protein PrpR (Ralstonia solanacearum IBSBF1503)
MSTAPHFAPRPRIWACGISRLSDLFLDIAAEYNDRAELRVITRGFEDIVREIDTAGAERP
DVVVAGGSNGAYLKPRLSLPVVVINPTGFDVMHALARARRDAESVALVTHGDTPDEVRRF
VAAYGMEVVFASYESRQDAESRVLDLRDRGVGAVVGPGLVTDLAAQAGMHAVFLYSRDSV
RAAFDTALEVVQATRREAQRRQRLDNLLQHLRDGVVALDAQGRVEAINQRLATALGIDAK
QAAGQPLLDIAPNLLGLLPDADGDMLGTVRGVSYVIHRGPLASTGAGAADGTVFTFQESR
AVERLDRTLRSGQRAPQFTARYRLDDLVGTSAPMERVRTLVRRYAKSDATVLVLGESGTG
KEMVAQGMHQLSARRDFPFVAINCGAFPEALLESELFGYEEGAFTGARKGGKAGLIEAAH
RGTLFLDEIGEMPLPLQSRLLRVLQEREVVRLGSTEPTRVDIRVVAATHRALTDAVEAGT
FRADLYYRLNILSIALPPLRDRPGDVMPLAADLLVQAARREPRLLLGIPDTEVAARALAG
VADPLRRYAWPGNVRELQSVIERIAVELADADDTGAGTVTHDVLRAIAPEVFAQAARGKK
ATLTLRERSRGAEAEAIRTALAAHGGDRDAVCAALGISKTTLWRRLNAE