Protein Info for RALBFv3_RS22505 in Ralstonia solanacearum IBSBF1503

Annotation: prolyl aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 TIGR01249: prolyl aminopeptidase" amino acids 12 to 314 (303 residues), 383.5 bits, see alignment E=3.3e-119 PF00561: Abhydrolase_1" amino acids 41 to 296 (256 residues), 106.1 bits, see alignment E=3.7e-34 PF12697: Abhydrolase_6" amino acids 41 to 299 (259 residues), 49.6 bits, see alignment E=1.2e-16 PF12146: Hydrolase_4" amino acids 63 to 297 (235 residues), 42.3 bits, see alignment E=8.5e-15

Best Hits

Swiss-Prot: 64% identical to PIP_SERMA: Proline iminopeptidase (pip) from Serratia marcescens

KEGG orthology group: K01259, proline iminopeptidase [EC: 3.4.11.5] (inferred from 93% identity to rsl:RPSI07_mp0147)

Predicted SEED Role

"Proline iminopeptidase (EC 3.4.11.5)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 3.4.11.5)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>RALBFv3_RS22505 prolyl aminopeptidase (Ralstonia solanacearum IBSBF1503)
MSELRPLYPAIEPYATGQLEVGNGHTVYYERVGTPGAKPAVFLHGGPGGGISADHRRLFD
PARYDVLLFDQRGCGRSTPHAGLEANTTWHLVDDIERLRKLAGAERWLVLGGSWGSTLAL
AYAQKHPERVSELVLRGIYTVSQAELDWYYQYGVSEMFPDKWVRFQAPIPEAERGSMIAA
YRKLLTGSDTQKQIEAARAWSVWEGETITLLPDPSNSAKHADDHFALAFARLENHYFTHR
CWLEDRQLLRDAHRLAGIPDVIVHGRYDMPCPVRYAYALHQAWPDAAFHLIEGAGHAWTE
PGILDQLIAATDRFAASHGR