Protein Info for RALBFv3_RS22230 in Ralstonia solanacearum IBSBF1503

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 816 transmembrane" amino acids 15 to 41 (27 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details PF02743: dCache_1" amino acids 44 to 273 (230 residues), 56.1 bits, see alignment E=1.1e-18 PF00989: PAS" amino acids 533 to 636 (104 residues), 36 bits, see alignment E=1.9e-12 PF08448: PAS_4" amino acids 534 to 641 (108 residues), 23.2 bits, see alignment E=2.1e-08 TIGR00229: PAS domain S-box protein" amino acids 535 to 646 (112 residues), 33.2 bits, see alignment E=4.9e-12 PF13426: PAS_9" amino acids 540 to 638 (99 residues), 28.3 bits, see alignment E=5.4e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 648 to 813 (166 residues), 150.2 bits, see alignment E=4.4e-48 PF00990: GGDEF" amino acids 651 to 811 (161 residues), 141 bits, see alignment E=9.3e-45

Best Hits

KEGG orthology group: None (inferred from 92% identity to rsl:RPSI07_mp0219)

Predicted SEED Role

"FIG00979031: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (816 amino acids)

>RALBFv3_RS22230 histidine kinase (Ralstonia solanacearum IBSBF1503)
MSTVLPPSAPRRLLFRLLPGVVCAALLPFVGLIAVAVSTVYDDTRREIDSRLEQAIAQAA
RPLEAHLTDAIDRLSAAADDAAAPASTREGQAWLDAHPELRGVFDNLLIVNATGVVLADA
PALPQRRGDNMAQHRIFKTVRESHRLYIPEPALTPDGQRPVASFAVPLHGPDGSFSGLVI
GSIELTRNPILADVENTRIGHSGRLLVVSGQGRYLVGPDRARLLQQAPDLAEGQPAARAR
AQGWNDSTEIHPPGQSPVIVSYRPLNAVPWSIGAWWPAQEAYAGAARTTRTLVAAGIAFG
AACLLFAWFWLERATNPLERLRHEVEAGMPIHTPLAPVGRPALSEPPAPGPIARLADLAH
PDARTFDPATEVGALAGSVGRLVQYWERALGTAEQEAAFFRAIAEQAPVGLAFLDRSLTV
PFANVRFERLVGTSSATIVRALQDGDSTTTSPAAQAVAAVLRQLPRAPLALADRPVVIAT
GEGAGSGAVLLTARPAGSAGAPPVGWIIAVVDATAEQRAKEALEHEVRAALLVLDAIQEP
LLTIDGDGIVTHASRAIETLTGTHPASAIGQSINRLLHLIEHETNRRVIPTQLLRSGGTL
PGGLRLETANGRRQDVELSWGPLPGTSGAGVVVLRDVSATRETVQRIAWDATHDVLTGLF
NRRGFDATLRAQVEAHRGARGAPRTPLALLMIDLDGFKAINDCYGHAAGDDVLRGIAERV
VQNTRTQDHAARLGGDEFAVILPNCDLQTAVTFADRIRAALVRQPVLAAGARAQIALSQG
VVELQADDADAAAFLARADTACYRAKSEGRNTIATG