Protein Info for RALBFv3_RS22130 in Ralstonia solanacearum IBSBF1503

Annotation: phosphatidylserine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00163: phosphatidylserine decarboxylase
  • amino acids 50 to 278 (229 residues), 238.6 bits, E=2.7e-75
• PF02666: PS_Dcarbxylase
  • amino acids 63 to 277 (215 residues), 211.1 bits, E=6.7e-67

Best Hits

Swiss-Prot: 68% identical to PSD_CHRVO: Phosphatidylserine decarboxylase proenzyme (psd) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 68% identity to cvi:CV_0591)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.65

Use Curated BLAST to search for 4.1.1.65

Protein Sequence (279 amino acids)

>RALBFv3_RS22130 phosphatidylserine decarboxylase (Ralstonia solanacearum IBSBF1503)
MSERLFVQLQHLLPKLLITRLLGFFARRRCGALTQWAIRRFIARYNVNLAEAEQTEPGAY
ATFNDFFTRALRPGARPLATARLVCPVDGAISQFGRIERDQIFQAKGKSFSSSALLAGNE
ELARQFDDGLFATLYLSPRDYHRIHMPCDGRLVSMRYVPGELYSVNPTTARAIDALFARN
ERVVCEFDSPHGPFALVLVGATIVGSIATAWHGVVNPPRSPSVRHWDYRDRNITLKQGEE
MGRFLLGSTVVLLFPQGPLQFNLDWAPTRAVHLGEAMAD