Protein Info for RALBFv3_RS21955 in Ralstonia solanacearum IBSBF1503

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF13673: Acetyltransf_10" amino acids 28 to 138 (111 residues), 62.7 bits, see alignment E=5.4e-21 PF00583: Acetyltransf_1" amino acids 37 to 130 (94 residues), 42.1 bits, see alignment E=1.4e-14 PF13508: Acetyltransf_7" amino acids 59 to 131 (73 residues), 41.3 bits, see alignment E=2.5e-14

Best Hits

KEGG orthology group: K03830, putative acetyltransferase [EC: 2.3.1.-] (inferred from 88% identity to rsl:RPSI07_mp0282)

Predicted SEED Role

"PhnO protein" in subsystem Alkylphosphonate utilization

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>RALBFv3_RS21955 GNAT family N-acetyltransferase (Ralstonia solanacearum IBSBF1503)
MVRIRSFHPGDEPTLHAIFYSAVHQLAATHYTAAQLAAWAPACHDPAQWAERIRRIQPCV
AEIDGRPVGYADLQPSGYIDHFFVCGTRARQGVGQALMDHLLGQAEARGIRTLSVQVSRN
AEPFFLRNGFIVAARQQVAVRGVILPNALMTRALP