Protein Info for RALBFv3_RS21745 in Ralstonia solanacearum IBSBF1503

Annotation: flagella basal body P-ring formation protein FlgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 59 (59 residues), see Phobius details PF17656: ChapFlgA_N" amino acids 110 to 169 (60 residues), 33.9 bits, see alignment E=5.1e-12 TIGR03170: flagella basal body P-ring formation protein FlgA" amino acids 159 to 294 (136 residues), 129.5 bits, see alignment E=4.1e-42 PF08666: SAF" amino acids 172 to 233 (62 residues), 45 bits, see alignment E=1.9e-15 PF13144: ChapFlgA" amino acids 172 to 293 (122 residues), 92.5 bits, see alignment E=3.2e-30

Best Hits

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 94% identity to rso:RSp0341)

Predicted SEED Role

"Flagellar basal-body P-ring formation protein FlgA" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>RALBFv3_RS21745 flagella basal body P-ring formation protein FlgA (Ralstonia solanacearum IBSBF1503)
MSTRPARSAYDPTLAVARRPRTIVRAQAMPPAARRRGLLLALALGLLASVAHPGRAHAQQ
MMRVGYTPANAAAAPAQAATTIQGPTAIQMQIQQQLQSQLDILNGTADDGGSRASVEVGP
VDPRVANQPCDQVELMLPSANRLRGRIQVGVRCRSPHAWAAWVPATIQISGTYYVAARQL
PPGKTLDMSDLEARTGDLSALPPSVVLQPADAVGRVLLTSLAPNQPLRAESLRMPIAIQA
GQTVKLVADGGGFQVTSDGRALNQAAIGQVAQVRTANGNVISGIAQSPGVVAVQF