Protein Info for RALBFv3_RS21590 in Ralstonia solanacearum IBSBF1503

Annotation: flagellar basal body M-ring protein FliF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 transmembrane" amino acids 48 to 68 (21 residues), see Phobius details amino acids 496 to 517 (22 residues), see Phobius details TIGR00206: flagellar M-ring protein FliF" amino acids 50 to 610 (561 residues), 417.8 bits, see alignment E=4.5e-129 PF01514: YscJ_FliF" amino acids 69 to 243 (175 residues), 240.7 bits, see alignment E=9.7e-76 PF08345: YscJ_FliF_C" amino acids 276 to 470 (195 residues), 145.9 bits, see alignment E=1.3e-46

Best Hits

KEGG orthology group: K02409, flagellar M-ring protein FliF (inferred from 94% identity to rsl:RPSI07_mp0346)

Predicted SEED Role

"Flagellar M-ring protein FliF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (611 amino acids)

>RALBFv3_RS21590 flagellar basal body M-ring protein FliF (Ralstonia solanacearum IBSBF1503)
MPTTADSVAVADTLGTVEMPAVGQGAITRKNAGVLGGLGPFGRLSPRTLAMIAAAALIAV
VAAATLWSRAPDYRVLYSNVADSDGGAIIAALQQMNVPYRFADGGSAIMVPEANVHEARL
KLAAQGLPKGGLAGFELMENQKFGTSQFAEQVNYQRALEGELARTIQAMQEVQSARVHLA
LSKPSVFVREQAKPSASVLLKLYPGRMLDRSQVQAIGHLVSSSVPNLPLANVTVVDQSGR
LLSSSFQDNASGLDPTQLNYVRDIEQGYIKRIEAILGPVVGEDNVRAQVTADVDLDNTEQ
MAETYRPNQDPANGVVRSTHTSESTQNKAGAQGGVPGALSNQPPAAPRMLPTAPAPASQQ
AAAGQNGQNAPNGQQQAAAATGQTATNNVESSARDTTINYEVDKTVRRTRAAVGTVRRLS
VAVVVNYRADGKTWKPLSDADMVKLNALVKDAVGYDAKRGDSVNVVNSQFSGTLPASRDD
LPLWKQPEMIHYAIQAAKYGALAIGFLILVFAVIRPLIRSMNKKEELATATFVGREGEDP
NAPIITGAAAPAGPELEGPSSASADGSEVPEELPQLKQNHEFEQKLETMRRIAQQNPRAV
AAVIKQWVSTE