Protein Info for RALBFv3_RS21465 in Ralstonia solanacearum IBSBF1503

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 19 to 168 (150 residues), 60.5 bits, see alignment E=7.5e-21 PF04542: Sigma70_r2" amino acids 21 to 82 (62 residues), 28.2 bits, see alignment E=2e-10 PF08281: Sigma70_r4_2" amino acids 116 to 167 (52 residues), 51.7 bits, see alignment E=8.2e-18 PF04545: Sigma70_r4" amino acids 121 to 168 (48 residues), 34.4 bits, see alignment E=1.9e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 85% identity to rsl:RPSI07_mp0376)

Predicted SEED Role

"PROBABLE EXTRACYTOPLASMIC FUNCTION SIGMA FACTOR TRANSCRIPTION REGULATOR PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>RALBFv3_RS21465 RNA polymerase sigma factor (Ralstonia solanacearum IBSBF1503)
MTMTGLHCDSVRSSLMAAFVDHYEELINHVRHRFGDQAFACDVVQDVCVQLLHRPPAEPV
CTPLAFLRHLSIHRAIDRWRSDETRAAYAELAGQAASDTDDVDGERIVASRQTVHQVEQV
IDGLPARCREVFILHKLHDLSQDEVAVRLSISRNMVAKHLARAMLAMRSISAVRRAPKPR
APMLMAYACGPDPCGV