Protein Info for RALBFv3_RS21450 in Ralstonia solanacearum IBSBF1503

Annotation: 2,3-diaminopropionate biosynthesis protein SbnB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 TIGR03944: 2,3-diaminopropionate biosynthesis protein SbnB" amino acids 9 to 338 (330 residues), 424 bits, see alignment E=1.8e-131 PF02423: OCD_Mu_crystall" amino acids 29 to 328 (300 residues), 196.9 bits, see alignment E=2.1e-62

Best Hits

Swiss-Prot: 58% identical to SBNB_STAA8: N-((2S)-2-amino-2-carboxyethyl)-L-glutamate dehydrogenase (sbnB) from Staphylococcus aureus (strain NCTC 8325)

KEGG orthology group: K01750, ornithine cyclodeaminase [EC: 4.3.1.12] (inferred from 96% identity to rsl:RPSI07_mp0379)

MetaCyc: 58% identical to N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase monomer (Staphylococcus aureus aureus NCTC 8325)
RXN-18393 [EC: 1.5.1.51]

Predicted SEED Role

"Ornithine cyclodeaminase (EC 4.3.1.12) / Siderophore staphylobactin biosynthesis protein SbnB" in subsystem Arginine and Ornithine Degradation or Siderophore Staphylobactin (EC 4.3.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.12

Use Curated BLAST to search for 1.5.1.51 or 4.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>RALBFv3_RS21450 2,3-diaminopropionate biosynthesis protein SbnB (Ralstonia solanacearum IBSBF1503)
MTQSADTGLLYLGRQDLVALGGDRSQPYVDAITEGLALHAKQDFVQPLKPYLRWPGADHI
ADRIIAMPCYVGGKKPIAGLKWIGSRQHNPSRFQLERASAVIVLNDADTNYPVAIMEGGL
ISGMRTAAISAVATRYLAREGFTDVACIGCGPIARMQMQTLIEQFPGIRRVHLFDVSREA
MRGFSEAIAARFPQVACQVADSAEQAVRAADVIVTCTVTDAPYLEYAWLRRGAFVCNVSI
MDVHKEVYEKADKVVVDDWDQSNREKKIINQLVLEGRFSRERLHAELGEIVVGERPGREN
DDEIILLNPMGMAIDDMVCARHFYQLAEQAGVGTRLPLL