Protein Info for RALBFv3_RS21340 in Ralstonia solanacearum IBSBF1503

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details transmembrane" amino acids 66 to 84 (19 residues), see Phobius details amino acids 96 to 121 (26 residues), see Phobius details amino acids 227 to 251 (25 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 52 to 150 (99 residues), 89.5 bits, see alignment E=8.3e-30 PF00528: BPD_transp_1" amino acids 72 to 256 (185 residues), 97.1 bits, see alignment E=5.5e-32

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 97% identity to rsl:RPSI07_mp0413)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>RALBFv3_RS21340 amino acid ABC transporter permease (Ralstonia solanacearum IBSBF1503)
MTFIFASWPVGWSRQQRSTLAMAAAAALLLGLLWLIAIPLAAAPEPIASNAQIFADGTRT
TVKLTLASALAGVLLGVMAALGKLSPVWLLRQAASFYIWVIRGTPLLVQILFVFLALPVW
LPWLQMDDFTSACVALAFNAGAYNAESIRAGLLAVPKGQLEAAHSLGLSRWHTFADVIFP
QAFKVALPPLVNNFIALLKDSSLAYAIGVVELTNVGNRLQAATFQPLPALVTTAVIYLAL
TTVLTQFSSAVEQRMDVEGRRR