Protein Info for RALBFv3_RS20865 in Ralstonia solanacearum IBSBF1503

Annotation: copper resistance system multicopper oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 623 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details TIGR01480: copper-resistance protein, CopA family" amino acids 11 to 622 (612 residues), 977.7 bits, see alignment E=1e-298 PF07732: Cu-oxidase_3" amino acids 67 to 175 (109 residues), 140.3 bits, see alignment E=4.7e-45 amino acids 514 to 622 (109 residues), 25.2 bits, see alignment E=2.2e-09 PF00394: Cu-oxidase" amino acids 186 to 359 (174 residues), 78.4 bits, see alignment E=1e-25 PF07731: Cu-oxidase_2" amino acids 506 to 622 (117 residues), 94.8 bits, see alignment E=5.8e-31

Best Hits

Swiss-Prot: 56% identical to PCOA_ECOLX: Copper resistance protein A (pcoA) from Escherichia coli

KEGG orthology group: None (inferred from 90% identity to rpf:Rpic12D_5336)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (623 amino acids)

>RALBFv3_RS20865 copper resistance system multicopper oxidase (Ralstonia solanacearum IBSBF1503)
MRSNRASRLLLPNLPRRRFVQGLAAGGVIAGLGLGGITSSLAAPSGATALGTAPVLRGTE
FDLVIDEMPVNYTGKPAMATTINGMLPGPTLRWREGDTVTIRVTNRLREATSIHWHGIIL
PFQMDGVPGISFHGIPPGETFTYRFKVQQSGSYWYHSHSGFQEMTGVYGGLIIDAAGGEP
IRADRDYTVLLSDWTDEDPMRVLSKLKTQGDYYNYHQPTVVDFFRDVSNDGWKAAADKRA
MWNQMRMSPTDLADLSSSTLTYLTNGVTPAGNWTGLFSPGETVRLRFINGSGNTFYDVRI
PGLKLKVVQVDGQNIEPVTVDEFRFGPGETCDALVSPKDDAYTIFSQSMDRTGYARGTLA
VHSGLQAAVPALDKVEWLSMSDMMGDMGGMGHGGTSGMNHGGLSGMDHGGMQMTGDSGGM
TMMDSGGMSMMDHRQHADAAGSADSLKVPSKKARHARTEYGPSTDMHVDMARTNLDDPGI
GLRNNGRRVLVLADMHTIGGPMDKRGPQREVELHLTGNMERYTWSFDGVEFGKSTPVHFR
YGERLRVILHNDTMMTHPMHLHGMWSELEAPDGTFQARRHTIPVQPAQRISFLVTADALG
RWVWHCHLMLHMDAGMFREVVVA