Protein Info for RALBFv3_RS20855 in Ralstonia solanacearum IBSBF1503

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 4 to 455 (452 residues), 450.5 bits, see alignment E=3.6e-139 PF21085: CusS" amino acids 4 to 156 (153 residues), 67.7 bits, see alignment E=2.6e-22 PF00672: HAMP" amino acids 180 to 232 (53 residues), 40 bits, see alignment 8.1e-14 PF00512: HisKA" amino acids 238 to 302 (65 residues), 49.5 bits, see alignment E=7.2e-17 PF02518: HATPase_c" amino acids 346 to 456 (111 residues), 82.4 bits, see alignment E=6.7e-27

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 89% identity to rpi:Rpic_1781)

Predicted SEED Role

"Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-)" in subsystem Potassium homeostasis (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>RALBFv3_RS20855 two-component sensor histidine kinase (Ralstonia solanacearum IBSBF1503)
MGQFSLTTRLTAYFSLCSATVLLGLGVVIALAMDQHFAVEDYTALRENVSVIQKVVESSP
AQQVPERIREALQHRTDLLVRVLGPDRQVLYATKDFDPQTAAQALARLRRNSDALVWEQG
GQQYRGMHAAILLRDGSSGALDILLGINTDIHAHFLHTFRRTLAFYIAVAALATGLFGWW
AARRGLAPLRTMASRARTVTADKLDERMPVETVPEEVADLAATLNAMLERLQNDFRRLSD
FSTDIAHELRTPITNLLTQTEVVLSQPREGTKYRDVLTSNAEELQRLARMVSDMLYLAKM
EHSLALPSAENIHVADEIRALFEFYDALAEDKAVQLELRGDGHVTGDRLMLRRALSNLLS
NAIRHTPRRGHVVVSVSDECEGVTISVDNDGSEIAPHLLPFIFERFFRADKSRARPESES
AGLGLAITKAIVVAHSGTIAVARVDGRTRFSIRLPHSIEEADRQA