Protein Info for RALBFv3_RS20760 in Ralstonia solanacearum IBSBF1503

Annotation: type I secretion system permease/ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 708 transmembrane" amino acids 156 to 179 (24 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 267 to 292 (26 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details PF03412: Peptidase_C39" amino acids 9 to 129 (121 residues), 47.6 bits, see alignment E=2.4e-16 TIGR01846: type I secretion system ATPase" amino acids 17 to 707 (691 residues), 919.2 bits, see alignment E=7.9e-281 PF00664: ABC_membrane" amino acids 159 to 420 (262 residues), 180.6 bits, see alignment E=7.9e-57 PF00005: ABC_tran" amino acids 487 to 636 (150 residues), 121 bits, see alignment E=9.3e-39

Best Hits

Swiss-Prot: 52% identical to RTX1B_ACTPL: Toxin RTX-I translocation ATP-binding protein (apxIB) from Actinobacillus pleuropneumoniae

KEGG orthology group: K11004, ATP-binding cassette, subfamily B, bacterial HlyB/CyaB (inferred from 60% identity to cti:pRALTA_0240)

Predicted SEED Role

"cyclolysin secretion ATP-binding protein" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (708 amino acids)

>RALBFv3_RS20760 type I secretion system permease/ATPase (Ralstonia solanacearum IBSBF1503)
MAGEEATIREEDIGALVLARIARYHGISVTVEQLRHDRGLGETAFSEDDLRRAAKSVGLK
SKIVKLRSLKLGSLPGPALMFDAAGRHFALVGVEGDEAHVWEPGVRHPSKIAITDVVSRS
NGKVMLVASRAPSFDTSATFDFSWFIPSIVRYRRLFGEVLFVSLVIQLVGLVAPLMYQAV
MDKAIPSRSYDTLSIVSIALLLSYTFEAALTAARGYVLSHTTNRVDVELGSKLIRHLLRL
PLDYFDARRVGDTASNARELENVRNFLTGQCLTAVIDIGFSAVFLSIMLYYSVPLTCIVL
ASLPLYVVLSISIGPTLQRRLKEKFARYADNQSLLMESVSAIETVKAMAIEPPFVRRWEE
QLAAYVSASFRASTLINVGQQIIQLIGKLTSLGILYFGAKLVMDGRMTIGGLVAFNMFAQ
RVASPILRLAQLWQDFQQVGISTQRLAKILNVKSEVPARQQALTSIRGDIWIDQVTFRYR
PNEAPALRGVSIKIRAGEVVGIIGRSGSGKSTLAKLLQRLYIPEQGHVFVDGVDLAMVDP
AWLRRQIGVVLQESRLFNRTIRENIAVGDPGAPLDQVVHAAQLAGAHEFITQLTEGYDTM
VGESGATLSGGQRQRIAIARALLKNPRILVFDEATSALDFETERIIHDNMQSICQGRTVI
VIAHRLTALRRVNRVIALDGGNIIEEGPQDELRQRGGYYATLHAIQSA