Protein Info for RALBFv3_RS20645 in Ralstonia solanacearum IBSBF1503

Annotation: phenylacetate-CoA oxygenase subunit PaaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 PF01883: FeS_assembly_P" amino acids 4 to 65 (62 residues), 57.4 bits, see alignment E=6.7e-20 TIGR02159: phenylacetate-CoA oxygenase, PaaJ subunit" amino acids 11 to 164 (154 residues), 199 bits, see alignment E=2.3e-63

Best Hits

KEGG orthology group: K02612, phenylacetic acid degradation protein (inferred from 92% identity to rsl:RPSI07_mp0488)

MetaCyc: 45% identical to anthraniloyl-[acp] 1,2-epoxidase subunit K (Streptomyces sp. S4(2010))
1.14.13.-

Predicted SEED Role

"Phenylacetate-CoA oxygenase, PaaJ subunit"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>RALBFv3_RS20645 phenylacetate-CoA oxygenase subunit PaaJ (Ralstonia solanacearum IBSBF1503)
MARARAALDAVADPEIPVVSIAELGILRDVSIDETGTLAVTITPTYSGCPAMEQIADDVT
RALQAAGVGAFCVRTALSPAWTTDWITPEGRRKLHHFGIAPPAHVVAAGAARPIRLVRSA
EADRVACPQCGSLDTVLVSAFGSTACKALYRCRACREPFDYFKPY