Protein Info for RALBFv3_RS20550 in Ralstonia solanacearum IBSBF1503

Annotation: 5,6-dimethylbenzimidazole synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 TIGR02476: 5,6-dimethylbenzimidazole synthase" amino acids 7 to 207 (201 residues), 261.9 bits, see alignment E=1.6e-82 PF00881: Nitroreductase" amino acids 19 to 183 (165 residues), 112.8 bits, see alignment E=1e-36

Best Hits

KEGG orthology group: K04719, 5,6-dimethylbenzimidazole synthase [EC: 1.14.99.40] (inferred from 94% identity to rsl:RPSI07_mp0498)

Predicted SEED Role

"Cobalamin biosynthesis protein BluB @ 5,6-dimethylbenzimidazole synthase, flavin destructase family"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.99.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>RALBFv3_RS20550 5,6-dimethylbenzimidazole synthase (Ralstonia solanacearum IBSBF1503)
MNPTYRYADADVAAVYRVIRERRDMRHFRPDPIEPALLERLLRAAHLAPSVGYMQPWRFI
RITDAALRARIHALVDEERHLTARALGQREDDFLRLKVEGILDCGEVLVAALMDKREPHI
FGRRTLPEMDLASVACAIQNLWLAARAEGIGVGWVSMFDPQQLGRLLHLPAGARPVAMLC
LGHVDAFYDRPMLEQENWAGRQPLESMLFENRWQAD