Protein Info for RALBFv3_RS20470 in Ralstonia solanacearum IBSBF1503

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 116 (103 residues), 60.5 bits, see alignment E=9e-21 PF00528: BPD_transp_1" amino acids 34 to 209 (176 residues), 52.5 bits, see alignment E=2.7e-18

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 93% identity to rsl:RPSI07_mp0514)

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>RALBFv3_RS20470 amino acid ABC transporter permease (Ralstonia solanacearum IBSBF1503)
MPDSLFATLLHWAPALLRGLSVNVGISLLAVGLGTVAGLAVGALRLSPLRPVQRLAGGYV
IALRNVPWLVLVYFMSYAVPFEIVLRGHVLPFPDWLKVTLALALPASAHVAEIFRGAVLS
IPSTQWEAAASLAFRRRDILWRIVLPQCVRRMLPSWMNLVAIIAMGTALASLVGVHDLLD
TAQIASNTVNRIPFTVATYFTVLGLFFLYCYPIARLTRRLEHRHVVA